PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c5_7650V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 1349aa    MW: 147935 Da    PI: 6.7846
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c5_7650V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-16598644148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g W++eEd  lv +v+++G  +W++Ia  ++ gR +kqc++rw+++l
  Pp3c5_7650V3.3.p 598 KGQWSPEEDRYLVGLVEMHGQQRWSLIATQLP-GRIGKQCRERWHNHL 644
                       799*****************************.*************97 PP

2Myb_DNA-binding54.33e-17650692145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       r+ W teE+e lv a+++lG++ W+ Ia++++ gRt++ +k++w+
  Pp3c5_7650V3.3.p 650 RDGWNTEEEEALVSAHNKLGNR-WADIAKMIP-GRTENAIKNHWN 692
                       567*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.718593648IPR017930Myb domain
SuperFamilySSF466891.95E-29595691IPR009057Homeodomain-like
SMARTSM007174.0E-15597646IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-27599651IPR009057Homeodomain-like
PfamPF139213.5E-17601661No hitNo description
CDDcd001673.08E-13601644No hitNo description
SMARTSM007178.7E-16649697IPR001005SANT/Myb domain
PROSITE profilePS5129419.42649699IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.8E-20652698IPR009057Homeodomain-like
CDDcd001677.47E-12653692No hitNo description
Gene3DG3DSA:3.90.1170.403.1E-912611338IPR003448Molybdopterin biosynthesis MoaE
PfamPF023914.1E-812641334IPR003448Molybdopterin biosynthesis MoaE
SuperFamilySSF546908.5E-812721338IPR003448Molybdopterin biosynthesis MoaE
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006777Biological ProcessMo-molybdopterin cofactor biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1349 aa     Download sequence    Send to blast
MQGSMTHKDI SGMFTNAAPS PSGPLSPRAG SALSPGGPYT VDIRMQLSVS DTKFSGSSTN  60
VDVLATLGGS SEATALNKSQ SVGSSLQNQN LSQLLRSAPG YGASSADQQH GATSNFTKSV  120
GMESETLAML QRQQHAATSN FPKLVEMESK TLDMLQRQQQ QQQASIHQHQ EYEHQGNNSV  180
EGLIYDISAE TSSGCRRRRI RDWSSDFQER CSQVNLEDWA SPRSTDGEEH ISLHMHDQWN  240
TTKNHELATA LQDCAPTTIR SKKAKVLKLQ HHPREDPRCI VMSSPVSASQ DKCRTNSGTT  300
WEIHLQQWNG MQRSSKLGAV ATGKHAEAGS ASPEGHGSIS LGAPHVLVDL DDEKKLTEIH  360
SEEARIKSSV SMTRSSEDNM KSLQETHRNI DLHHPNPCRV AGAGISFEMG SNTFLSNGMT  420
KSYETRELPN QLCSGNGYVG GSAFTGMEAW PQGGGGANDY LLHTSAAHIA HLLDFQIQEN  480
QRHLKQGILN YLPDDYMSGS RLADTVDYET GLRTGSSGVN LQKNGSSLCY SDLSMLPGQE  540
FAAANDTLLD SRCSSDEHLE ARAAYEMART EQHQAGLLSK SGFKRSSKGG PRRPNIIKGQ  600
WSPEEDRYLV GLVEMHGQQR WSLIATQLPG RIGKQCRERW HNHLRPDIKR DGWNTEEEEA  660
LVSAHNKLGN RWADIAKMIP GRTENAIKNH WNATMRRKDM RRKHRRVTDG SSDSLEVVPR  720
CTILRDYQQK VVAQRGGRKG KVLKSLATID NESRFNEGNR NDTQSRTSEL GSPHLTCDSP  780
SGWMSNETEK LSLPARFLEM STTEPDHTIV DMKIRASDSQ KECDRSRTTT HHAKGLAQDN  840
PFSLARSVGF EASSANPTKS LVSIWGQGAG SYSRPPVTFW GGEQWEGAGS EVFYTEPAAS  900
DRVENDDAAV WVTQINVPDF DVTPRFSDAA PVYQSSDIRN LKVTDQTMTF QLGTLDQIVN  960
GSSRSTSSPP PLLPDSLDVE AASSQSTQIL QQGKSTFTNK DLSTQAYLPL NATCSTLQGS  1020
DHFQTSVVLE KHVDNASGAA ESVVNFERTG IQNAGDNVLT LPERIGNYAH EIIRSTSTHP  1080
DNILTAASNI CKPMMVVGLS NNRTINIPNH QLPVNSFENT HASHVPRLPI FFGNLSHDTF  1140
SFHHQQAVNR VTGSPDHDIS DITSMLLPRV LISSMTDDIT SVTSGSTSFS NSDSLSRRYW  1200
NQSPQSSPKR GPSDLDLVEL VAKPLDQAPY LRKVKHHASS ESLRVSSNVC TVPNVSENGI  1260
DIRGINFHSH GHHEAESKLI HICSKMRSQW QLGCIALAHR MGVVGAGEVY AVVAVTSQDF  1320
SQATNAVNFA VECLQSEVSA FLHQDVLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-4359469854158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-4359469854158MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-435966982104C-Myb DNA-Binding Domain
1msf_C2e-435966982104C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S186_70V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.11e-47myb domain protein 119